Local view for "http://wifo5-04.informatik.uni-mannheim.de/drugbank/resource/drugs/DB02555"

PredicateValue (sorted: none)
rdfs:label
"SP4160"
rdf:type
owl:sameAs
drugbank:description
" experimental This compound belongs to the n-acyl-alpha amino acids and derivatives. These are compounds containing an alpha amino acid (or a derivative thereof) which bears an acyl group at his terminal nitrogen atom. N-acyl-alpha Amino Acids and Derivatives Organic Compounds Organic Acids and Derivatives Carboxylic Acids and Derivatives Amino Acids, Peptides, and Analogues Alpha Amino Acid Amides Phenylpyrazoles Anilides N-Acylpiperidines Benzylethers Dichlorobenzenes Phenol Ethers Alkyl Aryl Ethers Aryl Chlorides Tertiary Carboxylic Acid Amides Guanidines Tertiary Amines Secondary Carboxylic Acid Amides Polyamines Enolates Carboxylic Acids Amidines Organochlorides phenylpyrazole acetanilide n-acyl-piperidine benzylether 1,2-dichlorobenzene phenol ether chlorobenzene alkyl aryl ether benzene aryl halide aryl chloride piperidine azole pyrazole tertiary carboxylic acid amide guanidine secondary carboxylic acid amide carboxamide group tertiary amine amidine ether enolate carboxylic acid polyamine organochloride organonitrogen compound amine organohalogen logP 4.72 ALOGPS logS -5 ALOGPS Water Solubility 6.16e-03 g/l ALOGPS logP 3.41 ChemAxon IUPAC Name (2R)-2-[(diaminomethylidene)amino]-N-{2-[4-(3-{2,3-dichloro-4-[(4-acetamidophenyl)methoxy]phenyl}-1-methyl-1H-pyrazol-5-yl)piperidin-1-yl]-2-oxoethyl}-4-methylpentanamide ChemAxon Traditional IUPAC Name (2R)-2-[(diaminomethylidene)amino]-N-{2-[4-(5-{2,3-dichloro-4-[(4-acetamidophenyl)methoxy]phenyl}-2-methylpyrazol-3-yl)piperidin-1-yl]-2-oxoethyl}-4-methylpentanamide ChemAxon Molecular Weight 685.644 ChemAxon Monoisotopic Weight 684.270607286 ChemAxon SMILES CC(C)C[C@@H](N=C(N)N)C(=O)NCC(=O)N1CCC(CC1)C1=CC(=NN1C)C1=C(Cl)C(Cl)=C(OCC2=CC=C(NC(C)=O)C=C2)C=C1 ChemAxon Molecular Formula C33H42Cl2N8O4 ChemAxon InChI InChI=1S/C33H42Cl2N8O4/c1-19(2)15-26(40-33(36)37)32(46)38-17-29(45)43-13-11-22(12-14-43)27-16-25(41-42(27)4)24-9-10-28(31(35)30(24)34)47-18-21-5-7-23(8-6-21)39-20(3)44/h5-10,16,19,22,26H,11-15,17-18H2,1-4H3,(H,38,46)(H,39,44)(H4,36,37,40)/t26-/m1/s1 ChemAxon InChIKey InChIKey=VCXMTWSYQSVWRK-AREMUKBSSA-N ChemAxon Polar Surface Area (PSA) 169.96 ChemAxon Refractivity 194.97 ChemAxon Polarizability 72.99 ChemAxon Rotatable Bond Count 12 ChemAxon H Bond Acceptor Count 8 ChemAxon H Bond Donor Count 4 ChemAxon pKa (strongest acidic) 12.8 ChemAxon pKa (strongest basic) 10.6 ChemAxon Physiological Charge 1 ChemAxon Number of Rings 4 ChemAxon Bioavailability 0 ChemAxon MDDR-Like Rule true ChemAxon PubChem Compound 656989 PubChem Substance 46506770 ChemSpider 10645713 PDB FRI BE0001029 Interleukin-2 Human # Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. "Pubmed":http://www.ncbi.nlm.nih.gov/pubmed/17139284 # Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. "Pubmed":http://www.ncbi.nlm.nih.gov/pubmed/17016423 # Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. "Pubmed":http://www.ncbi.nlm.nih.gov/pubmed/10592235 unknown Interleukin-2 Involved in interleukin-2 receptor binding Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine- activated killer cells, natural killer cells, and glioma cells IL2 4q26-q27 Secreted protein None 7.95 17628.0 Human HUGO Gene Nomenclature Committee (HGNC) HGNC:6001 GenAtlas IL2 GeneCards IL2 GenBank Gene Database J00264 GenBank Protein Database 5729676 UniProtKB P60568 UniProt Accession IL2_HUMAN Aldesleukin IL-2 Interleukin-2 precursor T-cell growth factor TCGF >Interleukin-2 precursor MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE TTFMCEYADETATIVEFLNRWITFCQSIISTLT >462 bp ATGTACAGGATGCAACTCCTGTCTTGCATTGCACTAAGTCTTGCACTTGTCACAAACAGT GCACCTACTTCAAGTTCTACAAAGAAAACACAGCTACAACTGGAGCATTTACTGCTGGAT TTACAGATGATTTTGAATGGAATTAATAATTACAAGAATCCCAAACTCACCAGGATGCTC ACATTTAAGTTTTACATGCCCAAGAAGGCCACAGAACTGAAACATCTTCAGTGTCTAGAA GAAGAACTCAAACCTCTGGAGGAAGTGCTAAATTTAGCTCAAAGCAAAAACTTTCACTTA AGACCCAGGGACTTAATCAGCAATATCAACGTAATAGTTCTGGAACTAAAGGGATCTGAA ACAACATTCATGTGTGAATATGCTGATGAGACAGCAACCATTGTAGAATTTCTGAACAGA TGGATTACCTTTTGTCAAAGCATCATCTCAACACTGACTTGA PF00715 IL2 component extracellular region function growth factor activity function receptor binding function cytokine activity function hematopoietin/interferon-class (D200-domain) cytokine receptor binding function interleukin-2 receptor binding function signal transducer activity process response to stimulus process response to biotic stimulus process defense response process immune response "

All properties reside in the graph file:///home/swish/src/ClioPatria/guidelines3/drugbank_small.nt

The resource does not appear as an object

Context graph