Local view for "http://wifo5-04.informatik.uni-mannheim.de/drugbank/resource/drugs/DB02405"

PredicateValue (sorted: none)
drugbank:description
" 73367-80-3 experimental This compound belongs to the straight chain fatty acids. These are fatty acids with a straight aliphatic chain. Straight Chain Fatty Acids Organic Compounds Lipids Fatty Acids and Conjugates Straight Chain Fatty Acids Polyamines Carboxylic Acids Enolates Organobromides Alkyl Bromides enolate polyamine carboxylic acid derivative carboxylic acid organohalogen organobromide alkyl halide alkyl bromide logP 5.56 ALOGPS logS -5.3 ALOGPS Water Solubility 1.38e-03 g/l ALOGPS logP 4.58 ChemAxon IUPAC Name 12-bromododecanoic acid ChemAxon Traditional IUPAC Name 12-bromododecanoic acid ChemAxon Molecular Weight 279.214 ChemAxon Monoisotopic Weight 278.088142627 ChemAxon SMILES OC(=O)CCCCCCCCCCCBr ChemAxon Molecular Formula C12H23BrO2 ChemAxon InChI InChI=1S/C12H23BrO2/c13-11-9-7-5-3-1-2-4-6-8-10-12(14)15/h1-11H2,(H,14,15) ChemAxon InChIKey InChIKey=YYKBWYBUCFHYPR-UHFFFAOYSA-N ChemAxon Polar Surface Area (PSA) 37.3 ChemAxon Refractivity 66.64 ChemAxon Polarizability 29.3 ChemAxon Rotatable Bond Count 11 ChemAxon H Bond Acceptor Count 2 ChemAxon H Bond Donor Count 1 ChemAxon pKa (strongest acidic) 4.95 ChemAxon Physiological Charge -1 ChemAxon Number of Rings 0 ChemAxon Bioavailability 1 ChemAxon Rule of Five true ChemAxon Ghose Filter true ChemAxon ChEBI 30806 PubChem Compound 175468 PubChem Substance 46506537 ChemSpider 152887 PDB BRC BE0003957 Glycodelin Human # Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. "Pubmed":http://www.ncbi.nlm.nih.gov/pubmed/10592235 unknown Glycodelin Involved in binding This protein is, quantitatively, the main protein synthesized and secreted in the endometrium from mid-luteal phase of the menstrual cycle and during the first semester of pregnancy PAEP 9q34 None 5.26 20624.0 Human HUGO Gene Nomenclature Committee (HGNC) GNC:8573 GeneCards PAEP GenBank Gene Database J04129 GenBank Protein Database 190215 UniProtKB P09466 UniProt Accession PAEP_HUMAN GD PAEG PEG Placental protein 14 PP14 Pregnancy-associated endometrial alpha-2 globulin Progestagen-associated endometrial protein Progesterone-associated endometrial protein >Glycodelin MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVH ITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNF LFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF >489 bp GTGTCCCGGCCATGGACATCCCCCAGACCAAGCAGGACCTGGAGCTCCCAAAGTTGGCAG GGACCTGGCACTCCATGGCCATGGCGACCAACAACATCTCCCTCATGGCGACACTGAAGG CCCCTCTGAGGGTCCACATCACCTCACTGTTGCCCACCCCCGAGGACAACCTGGAGATCG TTCTGCACAGATGGGAGAACAACAGCTGTGTTGAGAAGAAGGTCCTTGGAGAGAAGACTG GGAATCCAAAGAAGTTCAAGATCAACTATACGGTGGCGAACGAGGCCACGCTGCTCGATA CTGACTACGACAATTTCCTGTTTCTCTGCCTACAGGACACCACCACCCCCATCCAGAGCA TGATGTGCCAGTACCTGGCCAGAGTCCTGGTGGAGGACGATGAGATCATGCAGGGATTCA TCAGGGCTTTCAGGCCCCTGCCCAGGCACCTATGGTACTTGCTGGACTTGAAACAGATGG AAGAGCCGT PF00061 Lipocalin function binding function transporter activity process physiological process process cellular physiological process process transport "
rdf:type
rdfs:label
"12-Bromododecanoic Acid"
owl:sameAs

All properties reside in the graph file:///home/swish/src/ClioPatria/guidelines3/drugbank_small.nt

The resource does not appear as an object

Context graph