Local view for "http://wifo5-04.informatik.uni-mannheim.de/drugbank/resource/drugs/DB01968"

PredicateValue (sorted: none)
rdf:type
owl:sameAs
drugbank:description
" experimental This compound belongs to the polyamines. These are compounds containing more than one amine group. Polyamines Organic Compounds Organonitrogen Compounds Amines Polyamines Enols Alkylthiols logP 0.26 ALOGPS logS -0.63 ALOGPS Water Solubility 1.77e+01 g/l ALOGPS logP -0.27 ChemAxon IUPAC Name (E)-2-aminoethene-1-thiol ChemAxon Traditional IUPAC Name 2-thioethenamine ChemAxon Molecular Weight 75.133 ChemAxon Monoisotopic Weight 75.014269855 ChemAxon SMILES N\C=C\S ChemAxon Molecular Formula C2H5NS ChemAxon InChI InChI=1S/C2H5NS/c3-1-2-4/h1-2,4H,3H2/b2-1+ ChemAxon InChIKey InChIKey=JLZMZFJVTNYDOT-OWOJBTEDSA-N ChemAxon Polar Surface Area (PSA) 26.02 ChemAxon Refractivity 21.81 ChemAxon Polarizability 7.73 ChemAxon Rotatable Bond Count 0 ChemAxon H Bond Acceptor Count 1 ChemAxon H Bond Donor Count 2 ChemAxon pKa (strongest acidic) 9.69 ChemAxon pKa (strongest basic) 5.7 ChemAxon Physiological Charge 0 ChemAxon Number of Rings 0 ChemAxon Bioavailability 1 ChemAxon Rule of Five true ChemAxon PubChem Compound 5806800 PubChem Substance 46505182 ChemSpider 2617384 PDB TEE BE0002667 Lantibiotic mersacidin Bacillus sp. (strain HIL-Y85/54728) unknown Lantibiotic mersacidin Kills a number of Gram-positive bacteria. Acts at the level of cell wall biosynthesis by interfering with bacterial peptidoglycan biosynthesis. Specifically inhibits the conversion of the lipid II intermediate into polymeric nascent glycan strands by transglycosylation. May interact with the peptidoglycan precursor rather than with the enzyme mrsA None 4.17 7228.0 Bacillus sp. (strain HIL-Y85/54728) GenBank Gene Database Z47559 UniProtKB P43683 UniProt Accession MRSA_BACSY Lantibiotic mersacidin precursor >Lantibiotic mersacidin MSQEAIIRSWKDPFSRENSTQNPAGNPFSELKEAQMDKLVGAGDMEAACTFTLPGGGGVC TLTSECIC >207 bp ATGAGTCAAGAAGCTATCATTCGTTCATGGAAAGATCCTTTTTCCCGTGAAAATTCTACA CAAAATCCAGCTGGTAACCCATTCAGTGAGCTGAAAGAAGCACAAATGGATAAGTTAGTA GGTGCGGGAGACATGGAAGCAGCATGTACTTTTACATTGCCTGGTGGCGGCGGTGTTTGT ACTCTAACTTCTGAATGTATTTGTTAA "
rdfs:label
"2-Thioethenamine"

All properties reside in the graph file:///home/swish/src/ClioPatria/guidelines3/drugbank_small.nt

The resource does not appear as an object

Context graph