Local view for "http://wifo5-04.informatik.uni-mannheim.de/drugbank/resource/drugs/DB01963"

PredicateValue (sorted: default)
rdfs:label
"Phenylethane Boronic Acid"
rdf:type
drugbank:description
" 34420-17-2 experimental This compound belongs to the benzene and substituted derivatives. These are aromatic compounds containing at least one benzene ring. Benzene and Substituted Derivatives Organic Compounds Benzenoids Benzene and Substituted Derivatives Boronic Acids Polyamines Organoboron Compounds boronic acid derivative polyamine organic metalloid moeity organoboron compound logP 1.42 ALOGPS logS -1.9 ALOGPS Water Solubility 1.82e+00 g/l ALOGPS logP 1.99 ChemAxon IUPAC Name (2-phenylethyl)boronic acid ChemAxon Traditional IUPAC Name 2-phenylethylboronic acid ChemAxon Molecular Weight 149.983 ChemAxon Monoisotopic Weight 150.085210062 ChemAxon SMILES OB(O)CCC1=CC=CC=C1 ChemAxon Molecular Formula C8H11BO2 ChemAxon InChI InChI=1S/C8H11BO2/c10-9(11)7-6-8-4-2-1-3-5-8/h1-5,10-11H,6-7H2 ChemAxon InChIKey InChIKey=VPRUMANMDWQMNF-UHFFFAOYSA-N ChemAxon Polar Surface Area (PSA) 40.46 ChemAxon Refractivity 40.21 ChemAxon Polarizability 16.91 ChemAxon Rotatable Bond Count 3 ChemAxon H Bond Acceptor Count 2 ChemAxon H Bond Donor Count 2 ChemAxon Physiological Charge 0 ChemAxon Number of Rings 1 ChemAxon Bioavailability 1 ChemAxon Rule of Five true ChemAxon PubChem Compound 65389 PubChem Substance 46505107 ChemSpider 58857 BindingDB 26142 PDB PBA BE0003531 Chymotrypsinogen B Human # Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. "Pubmed":http://www.ncbi.nlm.nih.gov/pubmed/17139284 # Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. "Pubmed":http://www.ncbi.nlm.nih.gov/pubmed/17016423 # Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. "Pubmed":http://www.ncbi.nlm.nih.gov/pubmed/10592235 unknown Chymotrypsinogen B Preferential cleavage:Tyr-|-Xaa, Trp-|-Xaa, Phe-|-Xaa, Leu-|-Xaa CTRB1 16q23-q24.1 Secreted, extracellular space None 7.17 27870.0 Human HUGO Gene Nomenclature Committee (HGNC) HGNC:2521 GenAtlas CTRB1 GeneCards CTRB1 GenBank Gene Database BC005385 UniProtKB P17538 UniProt Accession CTRB1_HUMAN Contains: RecName: Chymotrypsin B chain A Contains: RecName: Chymotrypsin B chain B Contains: RecName: Chymotrypsin B chain C >Chymotrypsinogen B MAFLWLLSCWALLGTTFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFC GGSLISEDWVVTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNND ITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPL LSNAECKKSWGRRITDVMICAGASGVSSCMGDSGGPLVCQKDGAWTLVGIVSWGSDTCST SSPGVYARVTKLIPWVQKILAAN PF00089 Trypsin function hydrolase activity function peptidase activity function endopeptidase activity function serine-type endopeptidase activity function catalytic activity process metabolism process macromolecule metabolism process protein metabolism process cellular protein metabolism process proteolysis process physiological process "
owl:sameAs

All properties reside in the graph file:///home/swish/src/ClioPatria/guidelines3/drugbank_small.nt

The resource does not appear as an object

Context graph